PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00066.1.g02950.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 395aa    MW: 42995.9 Da    PI: 8.0905
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00066.1.g02950.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.56.4e-2589132144
                             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                     d+epgrCrRtDGKkWRCs+++++++k+CE+H+hrg++rsrk++e
  Zjn_sc00066.1.g02950.1.sm.mkhc  89 DPEPGRCRRTDGKKWRCSQEAYPDSKYCEKHMHRGKNRSRKPVE 132
                                     79***************************************998 PP

2QLQ57.93e-201852236
                             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                                    +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ +++
  Zjn_sc00066.1.g02950.1.sm.mkhc 18 PFTATQWQELEHQALIYKCLASGKPIPSYLMPPLR 52
                                    9******************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.7E-111753IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.4E-141850IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.6061853IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.65889133IPR014977WRC domain
PfamPF088791.6E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MMMMTNRAGG GAGTGRYPFT ATQWQELEHQ ALIYKCLASG KPIPSYLMPP LRRILDTALD  60
TSPPLAFPPQ PSLGWGCYGM GFGRKADEDP EPGRCRRTDG KKWRCSQEAY PDSKYCEKHM  120
HRGKNRSRKP VEMSLATPTP SANAASAASA TTAVSSPAPS YHRQAAAAAH NATPYNALYC  180
GSPFAASTRP AAAGAYHAAS QVSPFQLHLD TTPPHPPGSY YALDQRDYAY GHTAKQVGEH  240
AFFTDGGASE RNRHAAGQWQ FTQLGMEPKP TTPSLFPDGG YGNGAASAYA VDMTKEDNEE  300
ERRHQQQHCF VLGTDLRLER PSNPDVPEAQ KPLRPFFDEW PHEKNSKGSW MGLGGETQLS  360
MGIPMAANDL PVTSHYRNGA PTSHVSVSYT PPTNV
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9702921e-146EU970292.1 Zea mays clone 343148 atGRF5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701613.10.0PREDICTED: growth-regulating factor 1-like isoform X2
SwissprotQ6AWY81e-159GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK3YTB60.0K3YTB6_SETIT; Uncharacterized protein
STRINGSi017511m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-49growth-regulating factor 5